Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr0198s0030.1
Common NameMTR_0198s0030
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family HD-ZIP
Protein Properties Length: 756aa    MW: 82233.9 Da    PI: 5.1338
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr0198s0030.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++k +++t++q++eLe++F+++++p++++r++L+kklgL  +qVk+WFqNrR+++k
                       79999************************************************999 PP

             START   2 laeeaaqelvkkalaeepgWvkss....esengdevlq.....kfeeskvdsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                       la++a++el+++ + ++p+W ks     e +n+de+ +     + ++++++ +ea r +g++  ++a lve++ld   qW e+++     a+t
                       6899********************999988888888763332244444449**************************.**********9**** PP

             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       l+vissg      g lq+m+ae q++splvp R + f+R+ +q+ +g wv+vdvSv++ ++  +  +++ +++lpSg+++e+++ng +k+twv
                       **************************************************************99***************************** PP

             START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       +h  ++++++h+++r+lv+sg+a+ga +wvatlqrqc 
                       ************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.04253113IPR001356Homeobox domain
SMARTSM003895.6E-1955117IPR001356Homeobox domain
PfamPF000464.4E-1956111IPR001356Homeobox domain
CDDcd000861.97E-1760113No hitNo description
PROSITE patternPS00027088111IPR017970Homeobox, conserved site
PROSITE profilePS5084843.299255491IPR002913START domain
SuperFamilySSF559614.73E-28258488No hitNo description
CDDcd088753.02E-97259486No hitNo description
SMARTSM002342.5E-37264488IPR002913START domain
PfamPF018521.2E-45265487IPR002913START domain
SuperFamilySSF559615.6E-12532748No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 756 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013442370.10.0homeobox leucine zipper protein
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLA0A072TS920.0A0A072TS92_MEDTR; Homeobox leucine zipper protein
STRINGGLYMA10G38280.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4